| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.7: ERP29 N domain-like [52892] (3 proteins) automatically mapped to Pfam PF07912 |
| Protein automated matches [254497] (1 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255077] (4 PDB entries) |
| Domain d2c0gb2: 2c0g B:1024-1145 [129593] Other proteins in same PDB: d2c0ga1, d2c0gb1 automated match to d1ovna2 complexed with cl, na; mutant |
PDB Entry: 2c0g (more details), 1.75 Å
SCOPe Domain Sequences for d2c0gb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2c0gb2 c.47.1.7 (B:1024-1145) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ctgcvdldelsfektverfpysvvkfdiaspygekheaftafsksahkatkdlliatvgv
kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
ig
Timeline for d2c0gb2: