SCOPe 2.08: Domain d2c0eb2: 2c0e B:24-145

Lineage for d2c0eb2 (2c0e B:24-145)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.7: ERP29 N domain-like [52892] (3 proteins)
   automatically mapped to Pfam PF07912

6. Protein automated matches [254497] (1 species)
   not a true protein

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255077] (4 PDB entries)

8. Domain d2c0eb2: 2c0e B:24-145 [129585]
   Other proteins in same PDB: d2c0ea1, d2c0eb1
   automated match to d1ovna2

Details for d2c0eb2

PDB Entry: 2c0e, 2.35 Å

PDB Description: structure of pdi-related chaperone, wind with his-tag on c-terminus.

PDB Compounds: (B:) windbeutel protein

SCOPe Domain Sequences for d2c0eb2:

Sequence; same for both SEQRES and ATOM records:

>d2c0eb2 c.47.1.7 (B:24-145) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlliatvgv
kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
ig

Timeline for d2c0eb2:

• d2c0eb2 first appeared in SCOP 1.73
  
• d2c0eb2 appears in SCOPe 2.07