Lineage for d2c0ea2 (2c0e A:24-145)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2877366Family c.47.1.7: ERP29 N domain-like [52892] (3 proteins)
    automatically mapped to Pfam PF07912
  6. 2877374Protein automated matches [254497] (1 species)
    not a true protein
  7. 2877375Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255077] (4 PDB entries)
  8. 2877381Domain d2c0ea2: 2c0e A:24-145 [129583]
    Other proteins in same PDB: d2c0ea1, d2c0eb1
    automated match to d1ovna2

Details for d2c0ea2

PDB Entry: 2c0e (more details), 2.35 Å

PDB Description: structure of pdi-related chaperone, wind with his-tag on c-terminus.
PDB Compounds: (A:) windbeutel protein

SCOPe Domain Sequences for d2c0ea2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2c0ea2 c.47.1.7 (A:24-145) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
ctgcvdldelsfektverfpysvvkfdiaypygekheaftafsksahkatkdlliatvgv
kdygelenkalgdrykvddknfpsiflfkgnadeyvqlpshvdvtldnlkafvsantply
ig

SCOPe Domain Coordinates for d2c0ea2:

Click to download the PDB-style file with coordinates for d2c0ea2.
(The format of our PDB-style files is described here.)

Timeline for d2c0ea2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2c0ea1