Lineage for d2bz4b1 (2bz4 B:1-253)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2916469Fold c.95: Thiolase-like [53900] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest
  4. 2916470Superfamily c.95.1: Thiolase-like [53901] (3 families) (S)
  5. 2916471Family c.95.1.1: Thiolase-related [53902] (20 proteins)
  6. 2916926Protein automated matches [231410] (2 species)
    not a true protein
  7. 2916927Species Escherichia coli [TaxId:562] [254877] (9 PDB entries)
  8. 2916941Domain d2bz4b1: 2bz4 B:1-253 [129544]
    Other proteins in same PDB: d2bz4a2, d2bz4b2, d2bz4c2, d2bz4d2
    automated match to d2bywa1
    complexed with nh4, so4; mutant

Details for d2bz4b1

PDB Entry: 2bz4 (more details), 1.86 Å

PDB Description: structure of e.coli kas i h298q mutant
PDB Compounds: (B:) 3-oxoacyl-[acyl-carrier-protein] synthase I

SCOPe Domain Sequences for d2bz4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bz4b1 c.95.1.1 (B:1-253) automated matches {Escherichia coli [TaxId: 562]}
mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli
drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam
rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg
kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv
eelehalargahi

SCOPe Domain Coordinates for d2bz4b1:

Click to download the PDB-style file with coordinates for d2bz4b1.
(The format of our PDB-style files is described here.)

Timeline for d2bz4b1: