Lineage for d2bymc_ (2bym C:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1262429Fold a.22: Histone-fold [47112] (1 superfamily)
    core: 3 helices; long middle helix is flanked at each end with shorter ones
  4. 1262430Superfamily a.22.1: Histone-fold [47113] (5 families) (S)
  5. 1262940Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)
  6. 1262947Protein Chrac-16 [140400] (1 species)
  7. 1262948Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140401] (2 PDB entries)
    Uniprot Q9V452 29-100
  8. 1262952Domain d2bymc_: 2bym C: [129495]
    Other proteins in same PDB: d2bymb_, d2bymd_
    automated match to d2byka1
    protein/DNA complex; complexed with cd

Details for d2bymc_

PDB Entry: 2bym (more details), 2.8 Å

PDB Description: histone fold heterodimer of the chromatin accessibility complex
PDB Compounds: (C:) chrac-16

SCOPe Domain Sequences for d2bymc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bymc_ a.22.1.3 (C:) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
glitnevlflmtkctelfvrhlagaayteefgqrpgealkyehlsqvvnknknlefllqi
vpqk

SCOPe Domain Coordinates for d2bymc_:

Click to download the PDB-style file with coordinates for d2bymc_.
(The format of our PDB-style files is described here.)

Timeline for d2bymc_: