SCOPe 2.02: Domain d2byka1: 2byk A:29-100

Lineage for d2byka1 (2byk A:29-100)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.22: Histone-fold [47112] (1 superfamily)
   core: 3 helices; long middle helix is flanked at each end with shorter ones

4. Superfamily a.22.1: Histone-fold [47113] (4 families)

5. Family a.22.1.3: TBP-associated factors, TAFs [47134] (14 proteins)

6. Protein Chrac-16 [140400] (1 species)

7. Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [140401] (2 PDB entries)
   Uniprot Q9V452 29-100

8. Domain d2byka1: 2byk A:29-100 [129486]
   Other proteins in same PDB: d2bykb1, d2bykd1
   protein/DNA complex; complexed with so4

Details for d2byka1

PDB Entry: 2byk, 2.4 Å

PDB Description: histone fold heterodimer of the chromatin accessibility complex

PDB Compounds: (A:) chrac-16

SCOPe Domain Sequences for d2byka1:

Sequence; same for both SEQRES and ATOM records:

>d2byka1 a.22.1.3 (A:29-100) Chrac-16 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
mkssmdtglitnevlflmtkctelfvrhlagaayteefgqrpgealkyehlsqvvnknkn
lefllqivpqki

Timeline for d2byka1:

• d2byka1 first appeared in SCOP 1.73
  
• d2byka1 appears in SCOPe 2.01
  
• d2byka1 appears in SCOPe 2.03
  
• d2byka1 appears in the current release, SCOPe 2.08