SCOPe 2.04: Domain d2bwsa1: 2bws A:1-176

Lineage for d2bwsa1 (2bws A:1-176)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (2 families)

5. Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (3 proteins)

6. Protein automated matches [254492] (1 species)
   not a true protein
7. Species Escherichia coli [TaxId:562] [255066] (7 PDB entries)

8. Domain d2bwsa1: 2bws A:1-176 [129381]
   Other proteins in same PDB: d2bwsa2
   automated match to d2v3za1
   complexed with cl, mn

Details for d2bwsa1

PDB Entry: 2bws, 1.75 Å

PDB Description: his243ala escherichia coli aminopeptidase p

PDB Compounds: (A:) xaa-pro aminopeptidase p

SCOPe Domain Sequences for d2bwsa1:

Sequence; same for both SEQRES and ATOM records:

>d2bwsa1 c.55.2.1 (A:1-176) automated matches {Escherichia coli [TaxId: 562]}
seisrqefqrrrqalveqmqpgsaalifaapevtrsadseypyrqnsdfwyftgfnepea
vlvliksddthnhsvlfnrvrdltaeiwfgrrlgqdaapeklgvdralafseinqqlyql
lngldvvyhaqgeyayadvivnsaleklrkgsrqnltapatmidwrpvvhemrlfk

Timeline for d2bwsa1:

• d2bwsa1 first appeared in SCOP 1.73
  
• d2bwsa1 appears in SCOPe 2.03
  
• d2bwsa1 appears in SCOPe 2.05
  
• d2bwsa1 appears in the current release, SCOPe 2.08