Lineage for d2bw1d_ (2bw1 D:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2314150Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 2314151Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 2314152Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 2314869Protein Dodecameric ferritin homolog [47250] (16 species)
  7. 2315165Species Streptococcus suis [TaxId:1307] [101134] (8 PDB entries)
  8. 2315229Domain d2bw1d_: 2bw1 D: [129308]
    automated match to d1umng_
    complexed with ca, epe, fe

Details for d2bw1d_

PDB Entry: 2bw1 (more details), 1.81 Å

PDB Description: iron-bound crystal structure of dps-like peroxide resistance protein (dpr) from streptococcus suis.
PDB Compounds: (D:) dps-like peroxide resistance protein

SCOPe Domain Sequences for d2bw1d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bw1d_ a.25.1.1 (D:) Dodecameric ferritin homolog {Streptococcus suis [TaxId: 1307]}
sladskavlnqavadlsvahsilhqvhwymrgrgfmiwhpkmdeymeeidgyldemserl
itlggapfstlkefsensqlkevlgdynvtieeqlarvvevfrylaalfqkgfdvsdeeg
dsvtndifnvakasiekhiwmlqaelgqapkl

SCOPe Domain Coordinates for d2bw1d_:

Click to download the PDB-style file with coordinates for d2bw1d_.
(The format of our PDB-style files is described here.)

Timeline for d2bw1d_: