SCOPe 2.08: Domain d2bvoa2: 2bvo A:1-181

Lineage for d2bvoa2 (2bvo A:1-181)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)

6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)

7. Species Human (Homo sapiens), HLA-B53 [TaxId:9606] [54474] (23 PDB entries)

8. Domain d2bvoa2: 2bvo A:1-181 [129289]
   Other proteins in same PDB: d2bvoa1, d2bvob_
   automatically matched to d1a1ma2

Details for d2bvoa2

PDB Entry: 2bvo, 1.65 Å

PDB Description: structures of three hiv-1 hla-b5703-peptide complexes and identification of related hlas potentially associated with long-term non-progression

PDB Compounds: (A:) hla class I histocompatibility antigen, b-57 alpha chain

SCOPe Domain Sequences for d2bvoa2:

Sequence; same for both SEQRES and ATOM records:

>d2bvoa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-B53 [TaxId: 9606]}
gshsmryfytamsrpgrgeprfiavgyvddtqfvrfdsdaasprmaprapwieqegpeyw
dgetrnmkasaqtyrenlrialryynqseagshiiqvmygcdvgpdgrllrghnqyaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlrayleglcvewlrrylengketlq
r

Timeline for d2bvoa2:

• d2bvoa2 first appeared in SCOP 1.73
  
• d2bvoa2 appears in SCOPe 2.07