Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.10: Acylphosphatase/BLUF domain-like [54975] (3 families) |
Family d.58.10.2: BLUF domain [143364] (4 proteins) Pfam PF04940; sensors of blue-light using FAD |
Protein Sensor of blue light AppA [143367] (1 species) |
Species Rhodobacter sphaeroides [TaxId:1063] [143368] (2 PDB entries) Uniprot Q53119 17-130! Uniprot Q53119 5-125 |
Domain d2buna1: 2bun A:5-125 [129223] complexed with fad |
PDB Entry: 2bun (more details)
SCOPe Domain Sequences for d2buna1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2buna1 d.58.10.2 (A:5-125) Sensor of blue light AppA {Rhodobacter sphaeroides [TaxId: 1063]} leadvtmtgsdlvsccyrslaapdltlrdlldivetsqahnaraqltgalfysqgvffqw leghpaavaevmshiqrdrrhsnveilaeesiakrrfagwhmqlscseadmrslglaesr q
Timeline for d2buna1: