Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.95: Thiolase-like [53900] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest |
Superfamily c.95.1: Thiolase-like [53901] (3 families) |
Family c.95.1.1: Thiolase-related [53902] (10 proteins) |
Protein Beta-ketoacyl-ACP synthase I [53907] (2 species) |
Species Escherichia coli [TaxId:562] [53908] (19 PDB entries) Uniprot P14926 |
Domain d2buid1: 2bui D:1-253 [129218] automated match to d1fj4a1 complexed with nh4, oca |
PDB Entry: 2bui (more details), 2.4 Å
SCOPe Domain Sequences for d2buid1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2buid1 c.95.1.1 (D:1-253) Beta-ketoacyl-ACP synthase I {Escherichia coli [TaxId: 562]} mkravitglgivssignnqqevlaslregrsgitfsqelkdsgmrshvwgnvkldttgli drkvvrfmsdasiyaflsmeqaiadaglspeayqnnprvgliagsgggsprfqvfgadam rgprglkavgpyvvtkamasgvsaclatpfkihgvnysissacatsahcignaveqiqlg kqdivfagggeelcwemacefdamgalstkyndtpekasrtydahrdgfviaggggmvvv eelehalargahi
Timeline for d2buid1: