Lineage for d2bufc_ (2buf C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1385579Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 1385580Superfamily c.73.1: Carbamate kinase-like [53633] (4 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 1385599Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)
  6. 1385618Protein automated matches [190527] (4 species)
    not a true protein
  7. 1385624Species Pseudomonas aeruginosa [TaxId:287] [187490] (1 PDB entry)
  8. 1385626Domain d2bufc_: 2buf C: [129193]
    Other proteins in same PDB: d2bufa1
    automated match to d2bufa1
    complexed with adp, cl, mg, nlg

Details for d2bufc_

PDB Entry: 2buf (more details), 2.95 Å

PDB Description: arginine feed-back inhibitable acetylglutamate kinase
PDB Compounds: (C:) acetylglutamate kinase

SCOPe Domain Sequences for d2bufc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bufc_ c.73.1.2 (C:) automated matches {Pseudomonas aeruginosa [TaxId: 287]}
tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkr

SCOPe Domain Coordinates for d2bufc_:

Click to download the PDB-style file with coordinates for d2bufc_.
(The format of our PDB-style files is described here.)

Timeline for d2bufc_: