Lineage for d2bufc1 (2buf C:2-300)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708177Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
    3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest
  4. 708178Superfamily c.73.1: Carbamate kinase-like [53633] (3 families) (S)
    the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase
  5. 708189Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (1 protein)
  6. 708190Protein N-acetyl-l-glutamate kinase [75298] (4 species)
  7. 708204Species Pseudomonas aeruginosa [TaxId:287] [142718] (1 PDB entry)
  8. 708207Domain d2bufc1: 2buf C:2-300 [129193]
    automatically matched to 2BUF A:2-301
    complexed with adp, cl, mg, nlg

Details for d2bufc1

PDB Entry: 2buf (more details), 2.95 Å

PDB Description: arginine feed-back inhibitable acetylglutamate kinase
PDB Compounds: (C:) acetylglutamate kinase

SCOP Domain Sequences for d2bufc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bufc1 c.73.1.2 (C:2-300) N-acetyl-l-glutamate kinase {Pseudomonas aeruginosa [TaxId: 287]}
tlsrddaaqvakvlsealpyirrfvgktlvikyggnameseelkagfardvvlmkavgin
pvvvhgggpqigdllkrlsieshfidgmrvtdaatmdvvemvlggqvnkdivnlinrhgg
saigltgkdaelirakkltvtrqtpemtkpeiidighvgevtgvnvgllnmlvkgdfipv
iapigvgsngesyninadlvagkvaealkaeklmlltniaglmdkqgqvltglsteqvne
liadgtiyggmlpkircaleavqggvtsahiidgrvpnavlleiftdsgvgtlisnrkr

SCOP Domain Coordinates for d2bufc1:

Click to download the PDB-style file with coordinates for d2bufc1.
(The format of our PDB-style files is described here.)

Timeline for d2bufc1: