Lineage for d2buca1 (2buc A:39-508)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419317Fold b.70: 8-bladed beta-propeller [50997] (3 superfamilies)
    consists of eight 4-stranded beta-sheet motifs; meander
    also found in some members of the WD40-repeat superfamily
  4. 2419478Superfamily b.70.3: DPP6 N-terminal domain-like [82171] (1 family) (S)
    automatically mapped to Pfam PF00930
  5. 2419479Family b.70.3.1: DPP6 N-terminal domain-like [82172] (3 proteins)
    Pfam PF00930
  6. 2419486Protein Dipeptidyl peptidase IV/CD26, N-terminal domain [82173] (2 species)
  7. 2419729Species Pig (Sus scrofa) [TaxId:9823] [89381] (8 PDB entries)
  8. 2419742Domain d2buca1: 2buc A:39-508 [129182]
    Other proteins in same PDB: d2buca2, d2bucb2, d2bucc2, d2bucd2
    automated match to d1orva1
    complexed with 008, nag, ndg, so4

Details for d2buca1

PDB Entry: 2buc (more details), 2.5 Å

PDB Description: crystal structure of porcine dipeptidyl peptidase iv (cd26) in complex with a tetrahydroisoquinoline inhibitor
PDB Compounds: (A:) dipeptidyl peptidase IV

SCOPe Domain Sequences for d2buca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2buca1 b.70.3.1 (A:39-508) Dipeptidyl peptidase IV/CD26, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]}
srrtytltdylkstfrvkfytlqwisdheylykqennillfnaeygnssiflenstfdel
gystndysvspdrqfilfeynyvkqwrhsytasydiydlnkrqliteeripnntqwitws
pvghklayvwnndiyvknepnlssqritwtgkenviyngvtdwvyeeevfsaysalwwsp
ngtflayaqfndtevplieysfysdeslqypktvripypkagaenptvkffvvdtrtlsp
nasvtsyqivppasvligdhylcgvtwvteerislqwirraqnysiidicdydestgrwi
ssvarqhieisttgwvgrfrpaephftsdgnsfykiisneegykhichfqtdksnctfit
kgawevigiealtsdylyyisnehkgmpggrnlyriqlndytkvtclscelnpercqyys
asfsnkakyyqlrcfgpglplytlhssssdkelrvlednsaldkmlqdvq

SCOPe Domain Coordinates for d2buca1:

Click to download the PDB-style file with coordinates for d2buca1.
(The format of our PDB-style files is described here.)

Timeline for d2buca1: