Lineage for d2bu3a1 (2bu3 A:29-238)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 715176Fold d.3: Cysteine proteinases [54000] (1 superfamily)
    consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn
  4. 715177Superfamily d.3.1: Cysteine proteinases [54001] (16 families) (S)
    the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet
  5. 715635Family d.3.1.14: Phytochelatin synthase [142867] (1 protein)
    Pfam PF05023; assosiated Pfam 09328 (DUF1984) is a part of the same functional unit
  6. 715636Protein Primitive phytochelatin synthase [142868] (1 species)
  7. 715637Species Nostoc sp. pcc 7120 [TaxId:103690] [142869] (2 PDB entries)
  8. 715638Domain d2bu3a1: 2bu3 A:29-238 [129167]
    automatically matched to 2BTW A:29-238
    complexed with 3gc, ca, cl

Details for d2bu3a1

PDB Entry: 2bu3 (more details), 1.4 Å

PDB Description: acyl-enzyme intermediate between alr0975 and glutathione at ph 3.4
PDB Compounds: (A:) alr0975 protein

SCOP Domain Sequences for d2bu3a1:

Sequence, based on SEQRES records: (download)

>d2bu3a1 d.3.1.14 (A:29-238) Primitive phytochelatin synthase {Nostoc sp. pcc 7120 [TaxId: 103690]}
lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginape
taqyspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnhasdtn
iedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyp
pvwvkttdlwkamntvdsvsqktrgfvfvs

Sequence, based on observed residues (ATOM records): (download)

>d2bu3a1 d.3.1.14 (A:29-238) Primitive phytochelatin synthase {Nostoc sp. pcc 7120 [TaxId: 103690]}
lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginayr
vftqdnffstkaviapevvarqgmtldelgrliasygvkvkvnhasdtniedfrkqvaen
lkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyppvwvkttdlwk
amntvdsvsqktrgfvfvs

SCOP Domain Coordinates for d2bu3a1:

Click to download the PDB-style file with coordinates for d2bu3a1.
(The format of our PDB-style files is described here.)

Timeline for d2bu3a1: