![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.14: Phytochelatin synthase [142867] (2 proteins) Pfam PF05023; assosiated Pfam PF09328 (DUF1984) is a part of the same functional unit |
![]() | Protein Primitive phytochelatin synthase [142868] (1 species) |
![]() | Species Nostoc sp. PCC 7120 [TaxId:103690] [142869] (2 PDB entries) Uniprot Q8YY76 29-238 |
![]() | Domain d2bu3a_: 2bu3 A: [129167] automated match to d2btwa1 complexed with 3gc, ca, cl |
PDB Entry: 2bu3 (more details), 1.4 Å
SCOPe Domain Sequences for d2bu3a_:
Sequence, based on SEQRES records: (download)
>d2bu3a_ d.3.1.14 (A:) Primitive phytochelatin synthase {Nostoc sp. PCC 7120 [TaxId: 103690]} lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginape taqyspyrvftqdnffsnektkaviapevvarqgmtldelgrliasygvkvkvnhasdtn iedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyp pvwvkttdlwkamntvdsvsqktrgfvfvsk
>d2bu3a_ d.3.1.14 (A:) Primitive phytochelatin synthase {Nostoc sp. PCC 7120 [TaxId: 103690]} lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginayr vftqdnffstkaviapevvarqgmtldelgrliasygvkvkvnhasdtniedfrkqvaen lkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyppvwvkttdlwk amntvdsvsqktrgfvfvsk
Timeline for d2bu3a_: