| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.85: RNA bacteriophage capsid protein [55404] (1 superfamily) 6-standed beta-sheet followed with 2 helices; meander |
Superfamily d.85.1: RNA bacteriophage capsid protein [55405] (1 family) ![]() |
| Family d.85.1.1: RNA bacteriophage capsid protein [55406] (6 proteins) |
| Protein MS2 virus coat protein [55407] (1 species) |
| Species Bacteriophage MS2 [TaxId:12022] [55408] (27 PDB entries) Uniprot P03612 |
| Domain d2bu1c_: 2bu1 C: [129166] automated match to d1dzsa_ protein/RNA complex |
PDB Entry: 2bu1 (more details), 2.2 Å
SCOPe Domain Sequences for d2bu1c_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bu1c_ d.85.1.1 (C:) MS2 virus coat protein {Bacteriophage MS2 [TaxId: 12022]}
asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
aiaansgiy
Timeline for d2bu1c_: