PDB entry 2bu1

View 2bu1 on RCSB PDB site
Description: ms2-RNA hairpin (5bru-5) complex
Class: virus/RNA
Keywords: virus/RNA, complex (capsid protein/RNA hairpin), hairpin, capsid, levivirus, capsid protein, RNA-binding, structural protein, icosahedral virus
Deposited on 2005-06-08, released 2005-08-18
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.219
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ms2 coat protein
    Species: BACTERIOPHAGE MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bu1a_
  • Chain 'B':
    Compound: ms2 coat protein
    Species: BACTERIOPHAGE MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bu1b_
  • Chain 'C':
    Compound: ms2 coat protein
    Species: BACTERIOPHAGE MS2 [TaxId:12022]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d2bu1c_
  • Chain 'R':
    Compound: 5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*up *5bu*ap*cp*cp*cp*ap*up*gp*u)-3'
    Species: BACTERIOPHAGE MS2, synthetic [TaxId:12022]
  • Chain 'S':
    Compound: 5'-r(*ap*cp*ap*up*gp*ap*gp*gp*ap*up *5bu*ap*cp*cp*cp*ap*up*gp*u)-3'
    Species: BACTERIOPHAGE MS2, synthetic [TaxId:12022]
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bu1A (A:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bu1B (B:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2bu1C (C:)
    asnftqfvlvdnggtgdvtvapsnfangvaewissnsrsqaykvtcsvrqssaqnrkyti
    kvevpkvatqtvggvelpvaawrsylnmeltipifatnsdcelivkamqgllkdgnpips
    aiaansgiy
    

  • Chain 'R':
    No sequence available.

  • Chain 'S':
    No sequence available.