SCOPe 2.07: Domain d2btyb_: 2bty B:

Lineage for d2btyb_ (2bty B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.73: Carbamate kinase-like [53632] (1 superfamily)
   3 layers: a/b/a; mixed (mainly parallel) beta-sheet of 8 strands, order 34215786; strand 8 is antiparallel to the rest

4. Superfamily c.73.1: Carbamate kinase-like [53633] (4 families)
   the sheet topology is similar to those of undecaprenyl diphosphate synthase and the N-terminal domain of phosphoglycerate kinase

5. Family c.73.1.2: N-acetyl-l-glutamate kinase [75297] (2 proteins)

6. Protein automated matches [190527] (4 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [187487] (1 PDB entry)

8. Domain d2btyb_: 2bty B: [129162]
   Other proteins in same PDB: d2btya1
   automated match to d2btya1
   complexed with arg, k, nlg

Details for d2btyb_

PDB Entry: 2bty, 2.75 Å

PDB Description: acetylglutamate kinase from thermotoga maritima complexed with its inhibitor arginine

PDB Compounds: (B:) acetylglutamate kinase

SCOPe Domain Sequences for d2btyb_:

Sequence; same for both SEQRES and ATOM records:

>d2btyb_ c.73.1.2 (B:) automated matches {Thermotoga maritima [TaxId: 2336]}
mridtvnvllealpyikefygktfvikfggsamkqenakkafiqdiillkytgikpiivh
gggpaisqmmkdlgiepvfknghrvtdektmeivemvlvgkinkeivmnlnlhggravgi
cgkdsklivaeketkhgdigyvgkvkkvnpeilhaliendyipviapvgigedghsynin
adtaaaeiakslmaeklilltdvdgvlkdgklistltpdeaeelirdgtvtggmipkvec
avsavrggvgavhiingglehailleifsrkgigtmikeleg

Timeline for d2btyb_:

• d2btyb_ first appeared in SCOP 1.73, called d2btyb1
  
• d2btyb_ appears in SCOPe 2.06
  
• d2btyb_ appears in the current release, SCOPe 2.08