SCOP 1.73: Domain d2btwb1: 2btw B:29-238

Lineage for d2btwb1 (2btw B:29-238)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (16 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.14: Phytochelatin synthase [142867] (1 protein)
   Pfam PF05023; assosiated Pfam 09328 (DUF1984) is a part of the same functional unit

6. Protein Primitive phytochelatin synthase [142868] (1 species)

7. Species Nostoc sp. pcc 7120 [TaxId:103690] [142869] (2 PDB entries)

8. Domain d2btwb1: 2btw B:29-238 [129160]
   complexed with ca

Details for d2btwb1

PDB Entry: 2btw, 2 Å

PDB Description: crystal structure of alr0975

PDB Compounds: (B:) alr0975 protein

SCOP Domain Sequences for d2btwb1:

Sequence; same for both SEQRES and ATOM records:

>d2btwb1 d.3.1.14 (B:29-238) Primitive phytochelatin synthase {Nostoc sp. pcc 7120 [TaxId: 103690]}
lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginape
taqyspyrvftqdnffsnektkaviapevvakqgmtldelgrliasygvkvkvnhasdtn
iedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyp
pvwvkttdlwkamntvdsvsqktrgfvfvs

Timeline for d2btwb1:

• d2btwb1 is new in SCOP 1.73
  
• d2btwb1 appears in SCOP 1.75
  
• d2btwb1 appears in the current release, SCOPe 2.08