Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (24 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.14: Phytochelatin synthase [142867] (2 proteins) Pfam PF05023; assosiated Pfam PF09328 (DUF1984) is a part of the same functional unit |
Protein Primitive phytochelatin synthase [142868] (1 species) |
Species Nostoc sp. PCC 7120 [TaxId:103690] [142869] (2 PDB entries) Uniprot Q8YY76 29-238 |
Domain d2btwb1: 2btw B:29-238 [129160] complexed with ca |
PDB Entry: 2btw (more details), 2 Å
SCOPe Domain Sequences for d2btwb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2btwb1 d.3.1.14 (B:29-238) Primitive phytochelatin synthase {Nostoc sp. PCC 7120 [TaxId: 103690]} lspnligfnsnegekllltsrsredffplsmqfvtqvnqaycgvasiimvlnslginape taqyspyrvftqdnffsnektkaviapevvakqgmtldelgrliasygvkvkvnhasdtn iedfrkqvaenlkqdgnfvivnylrkeigqergghisplaayneqtdrflimdvsrykyp pvwvkttdlwkamntvdsvsqktrgfvfvs
Timeline for d2btwb1: