Lineage for d2bt0b_ (2bt0 B:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2537076Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2537077Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2537078Family d.122.1.1: Heat shock protein 90, HSP90, N-terminal domain [55875] (2 proteins)
  6. 2537320Protein automated matches [190229] (13 species)
    not a true protein
  7. 2537333Species Human (Homo sapiens) [TaxId:9606] [187292] (156 PDB entries)
  8. 2537386Domain d2bt0b_: 2bt0 B: [129134]
    automated match to d1osfa_
    complexed with ct5

Details for d2bt0b_

PDB Entry: 2bt0 (more details), 1.9 Å

PDB Description: novel, potent small molecule inhibitors of the molecular chaperone hsp90 discovered through structure-based design
PDB Compounds: (B:) heat shock protein hsp90-alpha

SCOPe Domain Sequences for d2bt0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bt0b_ d.122.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
evetfafqaeiaqlmsliintfysnkeiflrelisnssdaldkiryesltdpskldsgke
lhinlipnkqdrtltivdtgigmtkadlinnlgtiaksgtkafmealqagadismigqfg
vgfysaylvaekvtvitkhnddeqyawessaggsftvrtdtgepmgrgtkvilhlkedqt
eyleerrikeivkkhsqfigypitlfvek

SCOPe Domain Coordinates for d2bt0b_:

Click to download the PDB-style file with coordinates for d2bt0b_.
(The format of our PDB-style files is described here.)

Timeline for d2bt0b_: