Lineage for d2bssa2 (2bss A:1-181)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. Protein Class I MHC, alpha-1 and alpha-2 domains [54468] (29 species)
  7. Species Human (Homo sapiens), HLA-BW44 [TaxId:9606] [102837] (19 PDB entries)
    Uniprot P30481 25-300
  8. Domain d2bssa2: 2bss A:1-181 [129110]
    Other proteins in same PDB: d2bssa1, d2bssb2, d2bssb3
    automatically matched to d1m6oa2

Details for d2bssa2

PDB Entry: 2bss (more details), 2 Å

PDB Description: crystal structures and kir3dl1 recognition of three immunodominant viral peptides complexed to hla-b2705
PDB Compounds: (A:) hla class I histocompatibility antigen b-27 alpha chain

SCOPe Domain Sequences for d2bssa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bssa2 d.19.1.1 (A:1-181) Class I MHC, alpha-1 and alpha-2 domains {Human (Homo sapiens), HLA-BW44 [TaxId: 9606]}
gshsmryfhtsvsrpgrgeprfitvgyvddtlfvrfdsdaaspreeprapwieqegpeyw
dretqickakaqtdredlrtllryynqseagshtlqnmygcdvgpdgrllrgyhqnaydg
kdyialnedlsswtaadtaaqitqrkweaarvaeqlraylegecvewlrrylengketlq
r

SCOPe Domain Coordinates for d2bssa2 are not available.

Timeline for d2bssa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bssa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2bssb2, d2bssb3