Lineage for d2bs2d1 (2bs2 D:458-655)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724371Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1724459Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 1724460Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 1724467Protein Fumarate reductase [46981] (2 species)
  7. 1724479Species Wolinella succinogenes [TaxId:844] [46983] (5 PDB entries)
  8. 1724481Domain d2bs2d1: 2bs2 D:458-655 [129036]
    Other proteins in same PDB: d2bs2a2, d2bs2a3, d2bs2b1, d2bs2b2, d2bs2c_, d2bs2d2, d2bs2d3, d2bs2e1, d2bs2e2, d2bs2f_
    automatically matched to d1e7pa1
    complexed with f3s, fad, fes, fum, hem, lmt, na, sf4

Details for d2bs2d1

PDB Entry: 2bs2 (more details), 1.78 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (D:) quinol-fumarate reductase flavoprotein subunit a

SCOPe Domain Sequences for d2bs2d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs2d1 a.7.3.1 (D:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
kgtedvfkiknrmkdvmddnvgifrdgphlekavkeleelykksknvgiknkrlhanpel
eeayrvpmmlkvalcvakgaldrtesrgahnredypkrddinwlnrtlaswpnpeqtlpt
leyealdvnemeiapgyrgygakgnyienplsvkrqeeidkiqseleaagkdrhaiqeal
mpyelpakykarnerlgd

SCOPe Domain Coordinates for d2bs2d1:

Click to download the PDB-style file with coordinates for d2bs2d1.
(The format of our PDB-style files is described here.)

Timeline for d2bs2d1: