Lineage for d2bs2a1 (2bs2 A:458-655)

  1. Root: SCOPe 2.02
  2. 1074916Class a: All alpha proteins [46456] (284 folds)
  3. 1081581Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down
  4. 1081658Superfamily a.7.3: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46977] (1 family) (S)
  5. 1081659Family a.7.3.1: Succinate dehydrogenase/fumarate reductase flavoprotein C-terminal domain [46978] (4 proteins)
  6. 1081666Protein Fumarate reductase [46981] (2 species)
  7. 1081678Species Wolinella succinogenes [TaxId:844] [46983] (5 PDB entries)
  8. 1081679Domain d2bs2a1: 2bs2 A:458-655 [129030]
    Other proteins in same PDB: d2bs2a2, d2bs2a3, d2bs2b1, d2bs2b2, d2bs2c_, d2bs2d2, d2bs2d3, d2bs2e1, d2bs2e2, d2bs2f_
    automatically matched to d1e7pa1
    complexed with f3s, fad, fes, fum, hem, lmt, na, sf4

Details for d2bs2a1

PDB Entry: 2bs2 (more details), 1.78 Å

PDB Description: quinol:fumarate reductase from wolinella succinogenes
PDB Compounds: (A:) quinol-fumarate reductase flavoprotein subunit a

SCOPe Domain Sequences for d2bs2a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bs2a1 a.7.3.1 (A:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]}
kgtedvfkiknrmkdvmddnvgifrdgphlekavkeleelykksknvgiknkrlhanpel
eeayrvpmmlkvalcvakgaldrtesrgahnredypkrddinwlnrtlaswpnpeqtlpt
leyealdvnemeiapgyrgygakgnyienplsvkrqeeidkiqseleaagkdrhaiqeal
mpyelpakykarnerlgd

SCOPe Domain Coordinates for d2bs2a1:

Click to download the PDB-style file with coordinates for d2bs2a1.
(The format of our PDB-style files is described here.)

Timeline for d2bs2a1: