SCOPe 2.04: Domain d2bq3a1: 2bq3 A:241-342

Lineage for d2bq3a1 (2bq3 A:241-342)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.240: Lesion bypass DNA polymerase (Y-family), little finger domain [100878] (1 superfamily)
   beta-alpha-beta(2)-alpha-beta; antiparallel beta-sheet: order 1423; "reversed" ferredoxin-like topology

4. Superfamily d.240.1: Lesion bypass DNA polymerase (Y-family), little finger domain [100879] (2 families)

5. Family d.240.1.0: automated matches [231323] (1 protein)
   not a true family

6. Protein automated matches [231324] (4 species)
   not a true protein

7. Species Sulfolobus solfataricus [TaxId:273057] [231327] (31 PDB entries)

8. Domain d2bq3a1: 2bq3 A:241-342 [128959]
   Other proteins in same PDB: d2bq3a2
   automated match to d2v4ra2
   complexed with ca

Details for d2bq3a1

PDB Entry: 2bq3, 2 Å

PDB Description: dna adduct bypass polymerization by sulfolobus solfataricus dpo4. analysis and crystal structures of multiple base-pair substitution and frameshift products with the adduct 1,n2-ethenoguanine

PDB Compounds: (A:) DNA polymerase IV

SCOPe Domain Sequences for d2bq3a1:

Sequence; same for both SEQRES and ATOM records:

>d2bq3a1 d.240.1.0 (A:241-342) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
vrksigrivtmkrnsrnleeikpylfraieesyykldkripkaihvvavtedldivsrgr
tfphgisketaysesvkllqkileederkirrigvrfskfie

Timeline for d2bq3a1:

• d2bq3a1 first appeared in SCOP 1.73
  
• d2bq3a1 appears in SCOPe 2.03
  
• d2bq3a1 appears in SCOPe 2.05
  
• d2bq3a1 appears in the current release, SCOPe 2.08