![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily) consists of two alpha+beta domains, C-terminal domain is mostly alpha helical |
![]() | Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) ![]() shares functional and structural similarities with the ATP-grasp fold and PIPK |
![]() | Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins) members organized in the groups and subfamiles specified by the comments |
![]() | Protein automated matches [190091] (20 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188447] (850 PDB entries) |
![]() | Domain d2bpmc2: 2bpm C:1-298 [128947] Other proteins in same PDB: d2bpma3, d2bpmb1, d2bpmb2, d2bpmc3, d2bpmd1, d2bpmd2 automated match to d1vywa_ complexed with 529, so4 |
PDB Entry: 2bpm (more details), 2.4 Å
SCOPe Domain Sequences for d2bpmc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bpmc2 d.144.1.7 (C:1-298) automated matches {Human (Homo sapiens) [TaxId: 9606]} menfqkvekigegtygvvykarnkltgevvalkkirldtetegvpstaireisllkelnh pnivklldvihtenklylvfeflhqdlkkfmdasaltgiplpliksylfqllqglafchs hrvlhrdlkpqnllintegaikladfglarafgvpvrtythevvtlwyrapeillgckyy stavdiwslgcifaemvtrralfpgdseidqlfrifrtlgtpdevvwpgvtsmpdykpsf pkwarqdfskvvppldedgrsllsqmlhydpnkrisakaalahpffqdvtkpvphlrl
Timeline for d2bpmc2: