Lineage for d2bpmb1 (2bpm B:175-309)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718077Family a.74.1.1: Cyclin [47955] (9 proteins)
  6. 2718090Protein Cyclin A [47956] (2 species)
  7. 2718126Species Human (Homo sapiens) [TaxId:9606] [47957] (89 PDB entries)
    Uniprot P20248 175-432
  8. 2718329Domain d2bpmb1: 2bpm B:175-309 [128945]
    Other proteins in same PDB: d2bpma2, d2bpma3, d2bpmc2, d2bpmc3
    automated match to d1vywb1
    complexed with 529, so4

Details for d2bpmb1

PDB Entry: 2bpm (more details), 2.4 Å

PDB Description: structure of cdk2-cyclin a with pha-630529
PDB Compounds: (B:) cyclin a2

SCOPe Domain Sequences for d2bpmb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpmb1 a.74.1.1 (B:175-309) Cyclin A {Human (Homo sapiens) [TaxId: 9606]}
vpdyhedihtylremevkckpkvgymkkqpditnsmrailvdwlvevgeeyklqnetlhl
avnyidrflssmsvlrgklqlvgtaamllaskfeeiyppevaefvyitddtytkkqvlrm
ehlvlkvltfdlaap

SCOPe Domain Coordinates for d2bpmb1:

Click to download the PDB-style file with coordinates for d2bpmb1.
(The format of our PDB-style files is described here.)

Timeline for d2bpmb1: