SCOP 1.75: Domain d2bpla2: 2bpl A:1-240

Lineage for d2bpla2 (2bpl A:1-240)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
   4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing

4. Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (7 families)
   N-terminal residue provides two catalytic groups, nucleophile and proton donor

5. Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
   has slightly different topology than other families do

6. Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)

7. Species Escherichia coli [TaxId:562] [56238] (5 PDB entries)
   Uniprot P17169 1-238

8. Domain d2bpla2: 2bpl A:1-240 [128939]
   Other proteins in same PDB: d2bpla1, d2bplb1, d2bplc1
   automatically matched to d1jxaa2
   complexed with f6r

Details for d2bpla2

PDB Entry: 2bpl, 2.05 Å

PDB Description: e coli glucosamine-6p synthase in complexe with fructose-6p

PDB Compounds: (A:) glucosamine--fructose-6-phosphate aminotransferase [isomerizing]

SCOP Domain Sequences for d2bpla2:

Sequence; same for both SEQRES and ATOM records:

>d2bpla2 d.153.1.1 (A:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

Timeline for d2bpla2:

• d2bpla2 first appeared in SCOP 1.73
  
• d2bpla2 appears in SCOPe 2.01
  
• d2bpla2 last appears in SCOPe 2.02