![]() | Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins) has slightly different topology than other families do |
![]() | Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species) |
![]() | Species Escherichia coli [TaxId:562] [56238] (5 PDB entries) |
![]() | Domain d2bpla2: 2bpl A:1-240 [128939] Other proteins in same PDB: d2bpla1, d2bplb1, d2bplc1 automatically matched to d1jxaa2 complexed with f6r |
PDB Entry: 2bpl (more details), 2.05 Å
SCOP Domain Sequences for d2bpla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bpla2 d.153.1.1 (A:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]} cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy
Timeline for d2bpla2:
![]() Domains from other chains: (mouse over for more information) d2bplb1, d2bplb2, d2bplc1, d2bplc2 |