Lineage for d2bpla2 (2bpl A:1-240)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 735798Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 735799Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (6 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 735800Family d.153.1.1: Class II glutamine amidotransferases [56236] (6 proteins)
    has slightly different topology than other families do
  6. 735840Protein Glucosamine 6-phosphate synthase, N-terminal domain [56237] (1 species)
  7. 735841Species Escherichia coli [TaxId:562] [56238] (5 PDB entries)
  8. 735846Domain d2bpla2: 2bpl A:1-240 [128939]
    Other proteins in same PDB: d2bpla1, d2bplb1, d2bplc1
    automatically matched to d1jxaa2
    complexed with f6r

Details for d2bpla2

PDB Entry: 2bpl (more details), 2.05 Å

PDB Description: e coli glucosamine-6p synthase in complexe with fructose-6p
PDB Compounds: (A:) glucosamine--fructose-6-phosphate aminotransferase [isomerizing]

SCOP Domain Sequences for d2bpla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bpla2 d.153.1.1 (A:1-240) Glucosamine 6-phosphate synthase, N-terminal domain {Escherichia coli [TaxId: 562]}
cgivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdiesnlqy

SCOP Domain Coordinates for d2bpla2:

Click to download the PDB-style file with coordinates for d2bpla2.
(The format of our PDB-style files is described here.)

Timeline for d2bpla2: