Lineage for d2bp7d1 (2bp7 D:2-205)

  1. Root: SCOP 1.75
  2. 814173Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 828800Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465
  4. 828801Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (8 families) (S)
    there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
    two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules
  5. 828995Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (4 proteins)
    parent family to TK and PFOR
    heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
  6. 828996Protein 2-oxoisovalerate dehydrogenase (E1B), Pyr module [88744] (1 species)
    chain A is alpha-subunit and chain B is beta-subunit
  7. 828997Species Pseudomonas putida [TaxId:303] [88745] (2 PDB entries)
  8. 829000Domain d2bp7d1: 2bp7 D:2-205 [128930]
    Other proteins in same PDB: d2bp7a1, d2bp7b2, d2bp7c1, d2bp7d2, d2bp7e1, d2bp7f2, d2bp7g1, d2bp7h2
    automatically matched to d1qs0b1

Details for d2bp7d1

PDB Entry: 2bp7 (more details), 2.9 Å

PDB Description: new crystal form of the pseudomonas putida branched-chain dehydrogenase (e1)
PDB Compounds: (D:) 2-oxoisovalerate dehydrogenase beta subunit

SCOP Domain Sequences for d2bp7d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bp7d1 c.36.1.7 (D:2-205) 2-oxoisovalerate dehydrogenase (E1B), Pyr module {Pseudomonas putida [TaxId: 303]}
atttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapis
esgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmpc
gggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyng
pfdghhdrpvtpwskhphsavpdg

SCOP Domain Coordinates for d2bp7d1:

Click to download the PDB-style file with coordinates for d2bp7d1.
(The format of our PDB-style files is described here.)

Timeline for d2bp7d1: