SCOPe 2.08: Domain d2bp7d1: 2bp7 D:2-205

Lineage for d2bp7d1 (2bp7 D:2-205)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.36: Thiamin diphosphate-binding fold (THDP-binding) [52517] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 6 strands, order 213465

4. Superfamily c.36.1: Thiamin diphosphate-binding fold (THDP-binding) [52518] (9 families)
   there are two different functional modules of this fold: pyridine-binding (Pyr) and pyrophosphate-binding (PP) modules
   two Pyr and two PP modules assemble together in a conserved heterotetrameric core that binds two THDP coenzyme molecules

5. Family c.36.1.7: Branched-chain alpha-keto acid dehydrogenase Pyr module [88741] (5 proteins)
   parent family to TK and PFOR
   heterodimeric protein related to TK; alpha-subunit is the PP module and the N-terminal domain of beta-subunit is the Pyr module
   automatically mapped to Pfam PF02779

6. Protein automated matches [254489] (1 species)
   not a true protein
7. Species Pseudomonas putida [TaxId:303] [255058] (1 PDB entry)

8. Domain d2bp7d1: 2bp7 D:2-205 [128930]
   Other proteins in same PDB: d2bp7a_, d2bp7b2, d2bp7c_, d2bp7d2, d2bp7e_, d2bp7f2, d2bp7g_, d2bp7h2
   automated match to d1qs0b1

Details for d2bp7d1

PDB Entry: 2bp7, 2.9 Å

PDB Description: new crystal form of the pseudomonas putida branched-chain dehydrogenase (e1)

PDB Compounds: (D:) 2-oxoisovalerate dehydrogenase beta subunit

SCOPe Domain Sequences for d2bp7d1:

Sequence; same for both SEQRES and ATOM records:

>d2bp7d1 c.36.1.7 (D:2-205) automated matches {Pseudomonas putida [TaxId: 303]}
atttmtmiqalrsamdvmlerddnvvvygqdvgyfggvfrcteglqtkygksrvfdapis
esgivgtavgmgayglrpvveiqfadyfypasdqivsemarlryrsagefiapltlrmpc
gggiyggqthsqspeamftqvcglrtvmpsnpydakglliasiecddpviflepkrlyng
pfdghhdrpvtpwskhphsavpdg

Timeline for d2bp7d1:

• d2bp7d1 first appeared in SCOP 1.73
  
• d2bp7d1 appears in SCOPe 2.07