SCOP 1.73: Domain d2bojb1: 2boj B:1-114

Lineage for d2bojb1 (2boj B:1-114)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
   sandwich; 9 strands in 2 sheets; greek-key

4. Superfamily b.115.1: Calcium-mediated lectin [82026] (1 family)

5. Family b.115.1.1: Calcium-mediated lectin [82027] (2 proteins)

6. Protein Fucose-binding lectin II (PA-LII) [82028] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [82029] (12 PDB entries)

8. Domain d2bojb1: 2boj B:1-114 [128913]
   automatically matched to d1gzta_
   complexed with arw, ca, so4

Details for d2bojb1

PDB Entry: 2boj, 1.8 Å

PDB Description: crystal structure of pseudomonas aeruginosa lectin (pa-iil) complexed with methyl-b-d-arabinopyranoside

PDB Compounds: (B:) pseudomonas aeruginosa lectin II

SCOP Domain Sequences for d2bojb1:

Sequence; same for both SEQRES and ATOM records:

>d2bojb1 b.115.1.1 (B:1-114) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

Timeline for d2bojb1:

• d2bojb1 is new in SCOP 1.73
  
• d2bojb1 appears in SCOP 1.75
  
• d2bojb1 appears in the current release, SCOPe 2.08, called d2bojb_