Class b: All beta proteins [48724] (165 folds) |
Fold b.115: Calcium-mediated lectin [82025] (1 superfamily) sandwich; 9 strands in 2 sheets; greek-key |
Superfamily b.115.1: Calcium-mediated lectin [82026] (1 family) |
Family b.115.1.1: Calcium-mediated lectin [82027] (2 proteins) |
Protein Fucose-binding lectin II (PA-LII) [82028] (1 species) |
Species Pseudomonas aeruginosa [TaxId:287] [82029] (12 PDB entries) |
Domain d2bojb1: 2boj B:1-114 [128913] automatically matched to d1gzta_ complexed with arw, ca, so4 |
PDB Entry: 2boj (more details), 1.8 Å
SCOP Domain Sequences for d2bojb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bojb1 b.115.1.1 (B:1-114) Fucose-binding lectin II (PA-LII) {Pseudomonas aeruginosa [TaxId: 287]} atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg
Timeline for d2bojb1: