Lineage for d2bojb_ (2boj B:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2409668Fold b.115: Calcium-mediated lectin [82025] (1 superfamily)
    sandwich; 9 strands in 2 sheets; greek-key
  4. 2409669Superfamily b.115.1: Calcium-mediated lectin [82026] (2 families) (S)
  5. 2409670Family b.115.1.1: Calcium-mediated lectin [82027] (3 protein domains)
    automatically mapped to Pfam PF07472
  6. 2409716Protein automated matches [190094] (4 species)
    not a true protein
  7. 2409804Species Pseudomonas aeruginosa, PA01 [TaxId:208964] [186987] (2 PDB entries)
  8. 2409810Domain d2bojb_: 2boj B: [128913]
    automated match to d1gzta_
    complexed with arw, ca, so4

Details for d2bojb_

PDB Entry: 2boj (more details), 1.8 Å

PDB Description: crystal structure of pseudomonas aeruginosa lectin (pa-iil) complexed with methyl-b-d-arabinopyranoside
PDB Compounds: (B:) pseudomonas aeruginosa lectin II

SCOPe Domain Sequences for d2bojb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bojb_ b.115.1.1 (B:) automated matches {Pseudomonas aeruginosa, PA01 [TaxId: 208964]}
atqgvftlpantrfgvtafanssgtqtvnvlvnnetaatfsgqstnnavigtqvlnsgss
gkvqvqvsvngrpsdlvsaqviltnelnfalvgsedgtdndyndavvvinwplg

SCOPe Domain Coordinates for d2bojb_:

Click to download the PDB-style file with coordinates for d2bojb_.
(The format of our PDB-style files is described here.)

Timeline for d2bojb_: