SCOPe 2.08: Domain d2bnoa1: 2bno A:4-76

Lineage for d2bnoa1 (2bno A:4-76)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)

6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)

7. Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
   Uniprot Q56185 6-76

8. Domain d2bnoa1: 2bno A:4-76 [128843]
   Other proteins in same PDB: d2bnoa2, d2bnob2
   automated match to d1zz6a1
   complexed with hg, so4, zn

Details for d2bnoa1

PDB Entry: 2bno, 1.9 Å

PDB Description: the structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis.

PDB Compounds: (A:) epoxidase

SCOPe Domain Sequences for d2bnoa1:

Sequence; same for both SEQRES and ATOM records:

>d2bnoa1 a.35.1.3 (A:4-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
tktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvl
gtsigaltppagn

Timeline for d2bnoa1:

• d2bnoa1 first appeared in SCOP 1.73
  
• d2bnoa1 appears in SCOPe 2.07