Lineage for d2bnnb1 (2bnn B:5-76)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. Family a.35.1.3: SinR domain-like [47432] (9 proteins)
  6. Protein Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain [140516] (1 species)
  7. Species Streptomyces wedmorensis [TaxId:43759] [140517] (14 PDB entries)
    Uniprot Q56185 6-76
  8. Domain d2bnnb1: 2bnn B:5-76 [128841]
    Other proteins in same PDB: d2bnna2, d2bnnb2
    automated match to d1zz6a1
    complexed with fcn, zn

Details for d2bnnb1

PDB Entry: 2bnn (more details), 2.5 Å

PDB Description: the structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis in complex with fosfomycin
PDB Compounds: (B:) epoxidase

SCOPe Domain Sequences for d2bnnb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnnb1 a.35.1.3 (B:5-76) Hydroxypropylphosphonic acid epoxidase Fom4, N-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
ktastgfaellkdrreqvkmdhaalasllgetpetvaawengeggeltltqlgriahvlg
tsigaltppagn

SCOPe Domain Coordinates for d2bnnb1 are not available.

Timeline for d2bnnb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bnnb2
View in 3D
Domains from other chains:
(mouse over for more information)
d2bnna1, d2bnna2