Lineage for d2bnna2 (2bnn A:77-198)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 962884Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
    one turn of helix is made by two pairs of antiparallel strands linked with short turns
    has appearance of a sandwich of distinct architecture and jelly-roll topology
  4. 962885Superfamily b.82.1: RmlC-like cupins [51182] (25 families) (S)
  5. 963191Family b.82.1.10: TM1459-like [101976] (2 proteins)
  6. 963192Protein Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain [141593] (1 species)
  7. 963193Species Streptomyces wedmorensis [TaxId:43759] [141594] (9 PDB entries)
    Uniprot Q56185 77-198
  8. 963204Domain d2bnna2: 2bnn A:77-198 [128840]
    Other proteins in same PDB: d2bnna1, d2bnnb1
    automatically matched to 1ZZ6 A:77-198
    complexed with fcn, zn

Details for d2bnna2

PDB Entry: 2bnn (more details), 2.5 Å

PDB Description: the structure of hydroxypropylphosphonic acid epoxidase from s. wedmorenis in complex with fosfomycin
PDB Compounds: (A:) epoxidase

SCOPe Domain Sequences for d2bnna2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bnna2 b.82.1.10 (A:77-198) Hydroxypropylphosphonic acid epoxidase Fom4, C-terminal domain {Streptomyces wedmorensis [TaxId: 43759]}
dlddgviiqmpderpilkgvrdnvdyyvynclvrtkrapslvplvvdvltdnpddakfns
ghagneflfvlegeihmkwgdkenpkeallptgasmfveehvphaftaakgtgsakliav
nf

SCOPe Domain Coordinates for d2bnna2:

Click to download the PDB-style file with coordinates for d2bnna2.
(The format of our PDB-style files is described here.)

Timeline for d2bnna2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bnna1