Lineage for d2bn7a2 (2bn7 A:177-439)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 732939Fold d.127: Creatinase/aminopeptidase [55919] (1 superfamily)
    duplication: composed of two very similar alpha+beta folds
  4. 732940Superfamily d.127.1: Creatinase/aminopeptidase [55920] (1 family) (S)
  5. 732941Family d.127.1.1: Creatinase/aminopeptidase [55921] (3 proteins)
  6. 732942Protein Aminopeptidase P, C-terminal domain [55928] (2 species)
  7. 732946Species Escherichia coli [TaxId:562] [55929] (23 PDB entries)
  8. 732963Domain d2bn7a2: 2bn7 A:177-439 [128821]
    Other proteins in same PDB: d2bn7a1
    automatically matched to d1a16_2
    complexed with flc, leu, mg, mn, pro, zn

Details for d2bn7a2

PDB Entry: 2bn7 (more details), 2.4 Å

PDB Description: mn substituted e. coli aminopeptidase p in complex with product and zn
PDB Compounds: (A:) xaa-pro aminopeptidase

SCOP Domain Sequences for d2bn7a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bn7a2 d.127.1.1 (A:177-439) Aminopeptidase P, C-terminal domain {Escherichia coli [TaxId: 562]}
speeiavlrrageitamahtramekcrpgmfeyhlegeihhefnrhgarypsyntivgsg
engcilhytenecemrdgdlvlidagceykgyagditrtfpvngkftqaqreiydivles
letslrlyrpgtsilevtgevvrimvsglvklgilkgdvdeliaqnahrpffmhglshwl
gldvhdvgvygqdrsrilepgmvltvepglyiapdaevpeqyrgigirieddivitetgn
enltasvvkkpeeiealmvaark

SCOP Domain Coordinates for d2bn7a2:

Click to download the PDB-style file with coordinates for d2bn7a2.
(The format of our PDB-style files is described here.)

Timeline for d2bn7a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bn7a1