Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) |
Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins) |
Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species) |
Species Mycobacterium tuberculosis [TaxId:1773] [142368] (1 PDB entry) Uniprot Q7BHK8 2-170 |
Domain d2bmxb_: 2bmx B: [128818] automated match to d2bmxa1 |
PDB Entry: 2bmx (more details), 2.4 Å
SCOPe Domain Sequences for d2bmxb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmxb_ c.47.1.10 (B:) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} plltigdqfpayqltaliggdlskvdakqpgdyfttitsdehpgkwrvvffwpkdftfvc pteiaafsklndefedrdaqilgvsidsefahfqwraqhndlktlpfpmlsdikrelsqa agvlnadgvadrvtfivdpnneiqfvsatagsvgrnvdevlrvldalqsdelcasnwr
Timeline for d2bmxb_: