SCOPe 2.07: Domain d2bmxb_: 2bmx B:

Lineage for d2bmxb_ (2bmx B:)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.10: Glutathione peroxidase-like [52901] (29 proteins)

6. Protein Alkyl hydroperoxide reductase AhpC [69516] (5 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [142368] (1 PDB entry)
   Uniprot Q7BHK8 2-170

8. Domain d2bmxb_: 2bmx B: [128818]
   automated match to d2bmxa1

Details for d2bmxb_

PDB Entry: 2bmx, 2.4 Å

PDB Description: mycobacterium tuberculosis ahpc

PDB Compounds: (B:) alkyl hydroperoxidase c

SCOPe Domain Sequences for d2bmxb_:

Sequence; same for both SEQRES and ATOM records:

>d2bmxb_ c.47.1.10 (B:) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]}
plltigdqfpayqltaliggdlskvdakqpgdyfttitsdehpgkwrvvffwpkdftfvc
pteiaafsklndefedrdaqilgvsidsefahfqwraqhndlktlpfpmlsdikrelsqa
agvlnadgvadrvtfivdpnneiqfvsatagsvgrnvdevlrvldalqsdelcasnwr

Timeline for d2bmxb_:

• d2bmxb_ first appeared in SCOP 1.73, called d2bmxb1
  
• d2bmxb_ appears in SCOPe 2.06
  
• d2bmxb_ appears in the current release, SCOPe 2.08