Class b: All beta proteins [48724] (174 folds) |
Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
Superfamily b.33.1: ISP domain [50022] (4 families) |
Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins) |
Protein Nitrobenzene dioxygenase alpha subunit, NBDO-alpha [141180] (1 species) |
Species Comamonas sp. JS765 [TaxId:58226] [141181] (3 PDB entries) Uniprot Q8RTL4 3-152 |
Domain d2bmqa1: 2bmq A:3-152 [128807] Other proteins in same PDB: d2bmqa2, d2bmqb_ automatically matched to 2BMO A:3-152 complexed with edo, eoh, fe, fes, nbz, ni |
PDB Entry: 2bmq (more details), 1.55 Å
SCOPe Domain Sequences for d2bmqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bmqa1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]} yqnlvseagltqkllihgdkelfqhelktifarnwlflthdslipspgdyvkakmgvdev ivsrqndgsvraflnvcrhrgktlvhaeagnakgfvcgyhgwgygsngelqsvpfekely gdaikkkclglkevpriesfhgfiygcfda
Timeline for d2bmqa1: