SCOPe 2.02: Domain d2bmqa1: 2bmq A:3-152

Lineage for d2bmqa1 (2bmq A:3-152)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.33: ISP domain [50021] (1 superfamily)
   consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)

4. Superfamily b.33.1: ISP domain [50022] (4 families)

5. Family b.33.1.2: Ring hydroxylating alpha subunit ISP domain [50033] (6 proteins)

6. Protein Nitrobenzene dioxygenase alpha subunit, NBDO-alpha [141180] (1 species)

7. Species Comamonas sp. JS765 [TaxId:58226] [141181] (3 PDB entries)
   Uniprot Q8RTL4 3-152

8. Domain d2bmqa1: 2bmq A:3-152 [128807]
   Other proteins in same PDB: d2bmqa2, d2bmqb_
   automatically matched to 2BMO A:3-152
   complexed with edo, eoh, fe, fes, nbz, ni

Details for d2bmqa1

PDB Entry: 2bmq, 1.55 Å

PDB Description: the crystal structure of nitrobenzene dioxygenase in complex with nitrobenzene

PDB Compounds: (A:) oxygenase-alpha nbdo

SCOPe Domain Sequences for d2bmqa1:

Sequence; same for both SEQRES and ATOM records:

>d2bmqa1 b.33.1.2 (A:3-152) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]}
yqnlvseagltqkllihgdkelfqhelktifarnwlflthdslipspgdyvkakmgvdev
ivsrqndgsvraflnvcrhrgktlvhaeagnakgfvcgyhgwgygsngelqsvpfekely
gdaikkkclglkevpriesfhgfiygcfda

Timeline for d2bmqa1:

• d2bmqa1 first appeared in SCOP 1.73
  
• d2bmqa1 appears in SCOPe 2.01
  
• d2bmqa1 appears in SCOPe 2.03
  
• d2bmqa1 appears in the current release, SCOPe 2.08