Lineage for d2bmoa2 (2bmo A:153-439)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1218105Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 1218323Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 1218397Family d.129.3.3: Ring hydroxylating alpha subunit catalytic domain [55969] (6 proteins)
    Pfam PF00848; contains a few insertion and C-terminal extension compared with Bet v1
  6. 1218439Protein Nitrobenzene dioxygenase alpha subunit, NBDO-alpha [143829] (1 species)
  7. 1218440Species Comamonas sp. JS765 [TaxId:58226] [143830] (3 PDB entries)
    Uniprot Q8RTL4 153-439
  8. 1218441Domain d2bmoa2: 2bmo A:153-439 [128805]
    Other proteins in same PDB: d2bmoa1, d2bmob1
    complexed with edo, eoh, fe, fes, ni

Details for d2bmoa2

PDB Entry: 2bmo (more details), 1.2 Å

PDB Description: the crystal structure of nitrobenzene dioxygenase
PDB Compounds: (A:) oxygenase-alpha nbdo

SCOPe Domain Sequences for d2bmoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bmoa2 d.129.3.3 (A:153-439) Nitrobenzene dioxygenase alpha subunit, NBDO-alpha {Comamonas sp. JS765 [TaxId: 58226]}
eapplidylgdaawyleptfkysgglelvgppgkvvvkanwksfaenfvgdgyhvgwtha
aalragqsvfssiagnaklppegaglqmtskygsgmgvfwgyysgnfsadmipdlmafga
akqeklakeigdvrariyrsflngtifpnnsfltgsaafrvwnpidenttevwtyafvek
dmpedlkrrvadavqrsigpagfwesddnenmetmsqngkkyqssnidqiaslgfgkdvy
gdecypgvvgksaigetsyrgfyrayqahisssnwaefenasrnwhi

SCOPe Domain Coordinates for d2bmoa2:

Click to download the PDB-style file with coordinates for d2bmoa2.
(The format of our PDB-style files is described here.)

Timeline for d2bmoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bmoa1
View in 3D
Domains from other chains:
(mouse over for more information)
d2bmob1