Lineage for d2blza_ (2blz A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2174483Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 2174484Superfamily d.5.1: RNase A-like [54076] (2 families) (S)
    can be classified as disulfide-rich
  5. 2174485Family d.5.1.1: Ribonuclease A-like [54077] (9 proteins)
  6. 2174918Protein automated matches [190061] (7 species)
    not a true protein
  7. 2174921Species Cow (Bos taurus) [TaxId:9913] [186780] (71 PDB entries)
  8. 2174927Domain d2blza_: 2blz A: [128747]
    automated match to d1a2wa_
    complexed with cl

Details for d2blza_

PDB Entry: 2blz (more details), 1.4 Å

PDB Description: rnase after a high dose x-ray "burn"
PDB Compounds: (A:) ribonuclease pancreatic

SCOPe Domain Sequences for d2blza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2blza_ d.5.1.1 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
ketaaakferqhmdsstsaasssnycnqmmksrnltkdrckpvntfvhesladvqavcsq
knvackngqtncyqsystmsitdcretgsskypncaykttqankhiivacegnpyvpvhf
dasv

SCOPe Domain Coordinates for d2blza_:

Click to download the PDB-style file with coordinates for d2blza_.
(The format of our PDB-style files is described here.)

Timeline for d2blza_: