Lineage for d2bkyb_ (2bky B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2957073Fold d.68: IF3-like [55199] (8 superfamilies)
    beta-alpha-beta-alpha-beta(2); 2 layers; mixed sheet 1243, strand 4 is antiparallel to the rest
  4. 2957430Superfamily d.68.6: AlbA-like [82704] (3 families) (S)
  5. 2957431Family d.68.6.1: DNA-binding protein AlbA [82705] (2 proteins)
  6. 2957450Protein automated matches [190221] (4 species)
    not a true protein
  7. 2957466Species Sulfolobus solfataricus [TaxId:273057] [186981] (1 PDB entry)
  8. 2957468Domain d2bkyb_: 2bky B: [128716]
    Other proteins in same PDB: d2bkyx_, d2bkyy_
    automated match to d1h0xa_
    complexed with mpd

Details for d2bkyb_

PDB Entry: 2bky (more details), 1.7 Å

PDB Description: crystal structure of the alba1:alba2 heterodimer from sulfolobus solfataricus
PDB Compounds: (B:) DNA/RNA-binding protein alba 1

SCOPe Domain Sequences for d2bkyb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bkyb_ d.68.6.1 (B:) automated matches {Sulfolobus solfataricus [TaxId: 273057]}
snvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrflpdkieik
eirvgsqvvtsqdgrqsrvstieiairkk

SCOPe Domain Coordinates for d2bkyb_:

Click to download the PDB-style file with coordinates for d2bkyb_.
(The format of our PDB-style files is described here.)

Timeline for d2bkyb_: