![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.15: beta-Grasp (ubiquitin-like) [54235] (15 superfamilies) core: beta(2)-alpha-beta(2); mixed beta-sheet 2143 |
![]() | Superfamily d.15.2: CAD & PB1 domains [54277] (3 families) ![]() contain extra helix; similar heterodimerization modes; possibly related to the ubiquitin-like superfamily |
![]() | Family d.15.2.2: PB1 domain [64225] (11 proteins) Pfam PF00564 forms heterodimers, although not all PB1 domain pairs associate. |
![]() | Protein Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) [117829] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [117830] (2 PDB entries) Uniprot Q14596 1-85 |
![]() | Domain d2bkfa1: 2bkf A:1-85 [128699] complexed with gol |
PDB Entry: 2bkf (more details), 1.56 Å
SCOPe Domain Sequences for d2bkfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bkfa1 d.15.2.2 (A:1-85) Next to BRCA1 gene 1 protein, NBR1 (KIAA0049) {Human (Homo sapiens) [TaxId: 9606]} mepqvtlnvtfkneiqsflvsdpenttwadieamvkvsfdlntiqikyldeeneevsins qgeyeealkmavkqgnqlqmqvheg
Timeline for d2bkfa1: