PDB entry 2bkf

View 2bkf on RCSB PDB site
Description: Structure of the PB1 domain of NBR1
Class: zinc-finger protein
Keywords: zinc-finger protein, pb1 domain, nbr1, interaction domain, zinc-finger
Deposited on 2005-02-16, released 2006-01-18
The last revision prior to the SCOPe 2.08 freeze date was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.56 Å
R-factor: N/A
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: zinc-finger protein nbr1 (next to breast cancer 1)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • PDB 2BKF (Start-1)
    • Uniprot Q14596 (2-86)
    Domains in SCOPe 2.08: d2bkfa1
  • Heterogens: GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >2bkfA (A:)
gamepqvtlnvtfkneiqsflvsdpenttwadieamvkvsfdlntiqikyldeeneevsi
nsqgeyeealkmavkqgnqlqmqvheg

    Sequence, based on observed residues (ATOM records): (download) 
    >2bkfA (A:)
amepqvtlnvtfkneiqsflvsdpenttwadieamvkvsfdlntiqikyldeeneevsin
sqgeyeealkmavkqgnqlqmqvheg