Lineage for d2bk6a1 (2bk6 A:7-156)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1264121Fold a.25: Ferritin-like [47239] (6 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 1264122Superfamily a.25.1: Ferritin-like [47240] (10 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 1264123Family a.25.1.1: Ferritin [47241] (10 proteins)
  6. 1264537Protein Dodecameric ferritin homolog [47250] (14 species)
  7. 1264715Species Listeria innocua [TaxId:1642] [47252] (4 PDB entries)
  8. 1264716Domain d2bk6a1: 2bk6 A:7-156 [128660]
    Other proteins in same PDB: d2bk6b_, d2bk6c_, d2bk6d_, d2bk6e_, d2bk6f_
    mutant

Details for d2bk6a1

PDB Entry: 2bk6 (more details), 2.19 Å

PDB Description: the x-ray crystal structure of the listeria innocua h31g dps mutant.
PDB Compounds: (A:) non-heme iron-containing ferritin

SCOPe Domain Sequences for d2bk6a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bk6a1 a.25.1.1 (A:7-156) Dodecameric ferritin homolog {Listeria innocua [TaxId: 1642]}
vdtkeflnhqvanlnvftvkihqigwymrghnfftlhekmddlysefgeqmdevaerlla
iggspfstlkeflenasveeapytkpktmdqlmedlvgtlellrdeykqgieltdkegdd
vtndmliafkasidkhiwmfkaflgkaple

SCOPe Domain Coordinates for d2bk6a1:

Click to download the PDB-style file with coordinates for d2bk6a1.
(The format of our PDB-style files is described here.)

Timeline for d2bk6a1: