Lineage for d2bjrb1 (2bjr B:6-184)

  1. Root: SCOPe 2.02
  2. 1103260Class b: All beta proteins [48724] (174 folds)
  3. 1143253Fold b.169: MFPT repeat-like [141738] (1 superfamily)
    consists of two similar pseudo barrel subdomains with structural similarity to a circularly permuted SAND domain (63764)
  4. 1143254Superfamily b.169.1: MFPT repeat-like [141739] (1 family) (S)
  5. 1143255Family b.169.1.1: MFPT repeat [141740] (1 protein)
    PfamB PB008194
  6. 1143256Protein Sperm motility protein MFP2 [141741] (2 species)
  7. 1143260Species Pig roundworm (Ascaris suum), isoform B [TaxId:6253] [141742] (1 PDB entry)
    Uniprot Q7YXJ9 185-368! Uniprot Q7YXJ9 6-184
    MFPTb
  8. 1143263Domain d2bjrb1: 2bjr B:6-184 [128630]
    automatically matched to 2BJR A:6-184
    complexed with so4, zn

Details for d2bjrb1

PDB Entry: 2bjr (more details), 1.8 Å

PDB Description: crystal structure of the nematode sperm cell motility protein mfp2b
PDB Compounds: (B:) mfp2b

SCOPe Domain Sequences for d2bjrb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bjrb1 b.169.1.1 (B:6-184) Sperm motility protein MFP2 {Pig roundworm (Ascaris suum), isoform B [TaxId: 6253]}
akedtwafgpigspfpdnpvkalgqqnmyvalwykngrpmhgrawnnggviecsfpynks
eltgvkdlggqiqvlqykgnhlslgywynwikysdrfdkmdkgaemlrcgdsfpilwser
pggallgyadnkteiarfshdgkvdevsgsalanmliiarelkggppyceceecksepp

SCOPe Domain Coordinates for d2bjrb1:

Click to download the PDB-style file with coordinates for d2bjrb1.
(The format of our PDB-style files is described here.)

Timeline for d2bjrb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2bjrb2