SCOPe 2.01: Domain d2bj7a2: 2bj7 A:51-132

Lineage for d2bj7a2 (2bj7 A:51-132)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.18: ACT-like [55021] (14 families)
   regulatory domain linked to a wide range of metabolic enzymes

5. Family d.58.18.4: Nickel responsive regulator NikR, C-terminal domain [102999] (1 protein)

6. Protein Nickel responsive regulator NikR, C-terminal domain [103000] (2 species)

7. Species Pyrococcus horikoshii [TaxId:53953] [143375] (5 PDB entries)
   Uniprot O58316 51-132

8. Domain d2bj7a2: 2bj7 A:51-132 [128609]
   Other proteins in same PDB: d2bj7a1, d2bj7b1
   automatically matched to 2BJ1 A:51-132
   complexed with cl, edo, ni, pg4

Details for d2bj7a2

PDB Entry: 2bj7, 2.1 Å

PDB Description: nikr in closed conformation and nickel bound to high-affinity sites

PDB Compounds: (A:) nickel responsive regulator

SCOPe Domain Sequences for d2bj7a2:

Sequence; same for both SEQRES and ATOM records:

>d2bj7a2 d.58.18.4 (A:51-132) Nickel responsive regulator NikR, C-terminal domain {Pyrococcus horikoshii [TaxId: 53953]}
neevagtitivynhdegdvvkalldlqheyldeiisslhvhmdehnclevivvkgeakki
kmiadkllslkgvkhgklvmts

Timeline for d2bj7a2:

• d2bj7a2 first appeared in SCOP 1.73
  
• d2bj7a2 appears in SCOP 1.75
  
• d2bj7a2 appears in SCOPe 2.02
  
• d2bj7a2 appears in the current release, SCOPe 2.08