Lineage for d2bhtc_ (2bht C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1387142Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 1387143Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) (S)
  5. 1387421Family c.79.1.0: automated matches [191338] (1 protein)
    not a true family
  6. 1387422Protein automated matches [190215] (18 species)
    not a true protein
  7. 1387444Species Escherichia coli [TaxId:562] [186974] (2 PDB entries)
  8. 1387446Domain d2bhtc_: 2bht C: [128552]
    Other proteins in same PDB: d2bhta1
    automated match to d1o58a_

Details for d2bhtc_

PDB Entry: 2bht (more details), 2.1 Å

PDB Description: crystal structure of o-acetylserine sulfhydrylase b
PDB Compounds: (C:) Cysteine synthase B

SCOPe Domain Sequences for d2bhtc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhtc_ c.79.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]}
mstleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgrikp
gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme
gardlalemanrgegklldqfnnpdnpkahytttgpeiwqqtggrithfvssmgttgtit
gvsefmreqskpvtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaent
mrelavregifcgvssggavagalrvakanpdavvvaiicdrgdrylstgvf

SCOPe Domain Coordinates for d2bhtc_:

Click to download the PDB-style file with coordinates for d2bhtc_.
(The format of our PDB-style files is described here.)

Timeline for d2bhtc_: