Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214 |
Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (2 families) |
Family c.79.1.0: automated matches [191338] (1 protein) not a true family |
Protein automated matches [190215] (18 species) not a true protein |
Species Escherichia coli [TaxId:562] [186974] (2 PDB entries) |
Domain d2bhtc_: 2bht C: [128552] Other proteins in same PDB: d2bhta1 automated match to d1o58a_ |
PDB Entry: 2bht (more details), 2.1 Å
SCOPe Domain Sequences for d2bhtc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2bhtc_ c.79.1.0 (C:) automated matches {Escherichia coli [TaxId: 562]} mstleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgrikp gdvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgme gardlalemanrgegklldqfnnpdnpkahytttgpeiwqqtggrithfvssmgttgtit gvsefmreqskpvtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaent mrelavregifcgvssggavagalrvakanpdavvvaiicdrgdrylstgvf
Timeline for d2bhtc_: