Lineage for d2bhtc1 (2bht C:2-292)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 708963Fold c.79: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53685] (1 superfamily)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 3214
  4. 708964Superfamily c.79.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53686] (1 family) (S)
  5. 708965Family c.79.1.1: Tryptophan synthase beta subunit-like PLP-dependent enzymes [53687] (8 proteins)
  6. 709069Protein O-acetylserine sulfhydrylase (Cysteine synthase) [53690] (7 species)
  7. 709073Species Escherichia coli, isoform B (CysM) [TaxId:562] [142744] (2 PDB entries)
  8. 709076Domain d2bhtc1: 2bht C:2-292 [128552]
    automatically matched to 2BHT A:2-293
    mutant

Details for d2bhtc1

PDB Entry: 2bht (more details), 2.1 Å

PDB Description: crystal structure of o-acetylserine sulfhydrylase b
PDB Compounds: (C:) Cysteine synthase B

SCOP Domain Sequences for d2bhtc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2bhtc1 c.79.1.1 (C:2-292) O-acetylserine sulfhydrylase (Cysteine synthase) {Escherichia coli, isoform B (CysM) [TaxId: 562]}
stleqtigntplvklqrmgpdngsevwlklegnnpagsvkdraalsmiveaekrgrikpg
dvlieatsgntgialamiaalkgyrmkllmpdnmsqerraamraygaelilvtkeqgmeg
ardlalemanrgegklldqfnnpdnpkahytttgpeiwqqtggrithfvssmgttgtitg
vsefmreqskpvtivglqpeegssipgirrwpteylpgifnaslvdevldihqrdaentm
relavregifcgvssggavagalrvakanpdavvvaiicdrgdrylstgvf

SCOP Domain Coordinates for d2bhtc1:

Click to download the PDB-style file with coordinates for d2bhtc1.
(The format of our PDB-style files is described here.)

Timeline for d2bhtc1: